PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01105.1.g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 352aa    MW: 38879.8 Da    PI: 5.1756
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01105.1.g00030.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.45e-1161971148
                                  HHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding 11 llvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                  +lv++v+q+G + W+ I+r ++ gR +kqc++rw+++l
  Zmw_sc01105.1.g00030.1.sm.mk 61 KLVKLVEQFGLKKWSCISRILP-GRVGKQCRERWHNHL 97
                                  8*********************.*************97 PP

2Myb_DNA-binding54.82.2e-17105145345
                                   SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
               Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                                    W+ eEd +l++a+k+ G++ W+ Ia++++ gRt++++k++w+
  Zmw_sc01105.1.g00030.1.sm.mk 105 IWSDEEDMILIQAHKEVGNK-WAEIAKRLP-GRTENSIKNHWN 145
                                   6*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171.0E-44899IPR001005SANT/Myb domain
CDDcd001672.02E-96097No hitNo description
Gene3DG3DSA:1.10.10.602.3E-2260105IPR009057Homeodomain-like
PROSITE profilePS500908.7466097IPR017877Myb-like domain
PfamPF002491.3E-86197IPR001005SANT/Myb domain
SuperFamilySSF466897.11E-2877153IPR009057Homeodomain-like
PROSITE profilePS5129424.73498152IPR017930Myb domain
SMARTSM007173.6E-17102150IPR001005SANT/Myb domain
PfamPF002498.4E-16106145IPR001005SANT/Myb domain
CDDcd001672.87E-14106148No hitNo description
Gene3DG3DSA:1.10.10.601.2E-21106150IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MQQNGFCHPV DHQFEGVGEY ASAGSVVSSA AFNDLGHQCH AEREARNGFG SYKAYEMSSR  60
KLVKLVEQFG LKKWSCISRI LPGRVGKQCR ERWHNHLRPD IKKDIWSDEE DMILIQAHKE  120
VGNKWAEIAK RLPGRTENSI KNHWNATKRR QFARRRSRAS SKAPKSGTLL QSYIKSLGIG  180
PTKTVETLLA QPPLSPSSSS PAPPGAKPAD FNDDGCPELE PDQSNAPNVQ GILRAIHENS  240
CGEVKPCEEL LGPICDGFLV DMGDGLFCTP EMAAFQVYSV GDEVDGDFIF NHLDCPVKVD  300
REEMCVDMAW VDDALGCVVE QGSCQSETMQ VIKEEVDLVE MVAASQEGTG QE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-416015113104C-Myb DNA-Binding Domain
1msf_C2e-416015113104C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004986186.21e-113PREDICTED: transcription factor MYB46-like
TrEMBLK4AJH61e-110K4AJH6_SETIT; Uncharacterized protein
STRINGSi039046m1e-110(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28063788